Question: Error with PrepareAnnotationRefseq: "tablenametotrack2: UCSC table "refGene" is not supported"
0
gravatar for samupatt
9 months ago by
samupatt0
samupatt0 wrote:

Commands entered:

 

> library('customProDB')
> library('rtracklayer')
> session <- browserSession()
> genome(session) <- 'hg19'
> dbsnps <- trackNames(session)[grep('snp', trackNames(session), fixed=T)]

> PrepareAnnotationRefseq(genome='hg19', CDSfasta="/home/shp12/UCSCData/refsequcsc.fasta", pepfasta="/home/shp12/UCSCData/refpepucsc.fasta", annotation_path="/home/shp12/Annotation_data")

Error obtained:

PrepareAnnotationRefseq(genome='hg19', CDSfasta="/home/shp12/UCSCData/refsequcsc.fasta", pepfasta="/home/shp12/UCSCData/refpeBuild TranscriptDB object (txdb.sqlite) ... nnotation_data")

Error in .tablename2track(tablename, session) :
  UCSC table "refGene" is not supported

sessionInfo()
R version 3.4.1 (2017-06-30)
Platform: x86_64-pc-linux-gnu (64-bit)
Running under: CentOS Linux 7 (Core)

Matrix products: default
BLAS/LAPACK: /n/app/openblas/0.2.19/lib/libopenblas_core2p-r0.2.19.so

locale:
 [1] LC_CTYPE=en_US.UTF-8       LC_NUMERIC=C
 [3] LC_TIME=en_US.UTF-8        LC_COLLATE=en_US.UTF-8
 [5] LC_MONETARY=en_US.UTF-8    LC_MESSAGES=en_US.UTF-8
 [7] LC_PAPER=en_US.UTF-8       LC_NAME=C
 [9] LC_ADDRESS=C               LC_TELEPHONE=C
[11] LC_MEASUREMENT=en_US.UTF-8 LC_IDENTIFICATION=C

attached base packages:
[1] stats4    parallel  stats     graphics  grDevices utils     datasets
[8] methods   base

other attached packages:
 [1] customProDB_1.18.0   BiocInstaller_1.28.0 rtracklayer_1.38.3
 [4] GenomicRanges_1.30.3 GenomeInfoDb_1.14.0  biomaRt_2.34.2
 [7] AnnotationDbi_1.40.0 Biobase_2.38.0       IRanges_2.12.0
[10] S4Vectors_0.16.0     BiocGenerics_0.24.0

loaded via a namespace (and not attached):
 [1] Rcpp_0.12.17               plyr_1.8.4
 [3] compiler_3.4.1             XVector_0.18.0
 [5] GenomicFeatures_1.30.3     prettyunits_1.0.2
 [7] bitops_1.0-6               tools_3.4.1
 [9] progress_1.2.0             zlibbioc_1.24.0
[11] digest_0.6.15              bit_1.1-14
[13] AhoCorasickTrie_0.1.0      BSgenome_1.46.0
[15] lattice_0.20-35            RSQLite_2.1.1
[17] memoise_1.1.0              pkgconfig_2.0.1
[19] rlang_0.2.1                Matrix_1.2-10
[21] DelayedArray_0.4.1         DBI_1.0.0
[23] GenomeInfoDbData_1.0.0     stringr_1.3.1
[25] httr_1.3.1                 Biostrings_2.46.0
[27] hms_0.4.2                  grid_3.4.1
[29] bit64_0.9-7                R6_2.2.2
[31] RMySQL_0.10.15             XML_3.98-1.11
[33] BiocParallel_1.12.0        blob_1.1.1
[35] magrittr_1.5               matrixStats_0.53.1
[37] GenomicAlignments_1.14.2   Rsamtools_1.30.0
[39] SummarizedExperiment_1.8.1 assertthat_0.2.0
[41] stringi_1.2.3              RCurl_1.95-4.10
[43] VariantAnnotation_1.24.5   crayon_1.3.4
>

Head of Sequence and Peptide files in question:

Pep:>NP_001337147.1
MMEGLKKRTRKAFGIRKKEKDTDSTGSPDRDGIKKSNGAPNGFYAEIDWE
RYNSPELDEEGYSIRPEEPGSTKGKHFYSSSESEEEEESHKKFNIKIKPL
QSKDILKNAATVDELKASIGNIALSPSPVRKSPRRSPGAIKRNLSSEEVA

Seq:
>hg19_refGene_NM_001350218 range=chr1:67000042-67208778 5'pad=0 3'pad=0 strand=+ repeatMasking=none
ATGATGGAAGGATTGAAAAAACGTACAAGGAAGGCCTTTGGAATACGGAA
GAAAGAAAAGGACACTGATTCTACAGGTTCACCAGATAGAGATGGAATTA
AGAAAAGCAATGGGGCACCAAATGGATTTTATGCGGAAATTGATTGGGAA

 

customprodb • 183 views
ADD COMMENTlink modified 8 months ago by xiaojing.wang50 • written 9 months ago by samupatt0
Answer: Error with PrepareAnnotationRefseq: "tablenametotrack2: UCSC table "refGene" is
0
gravatar for xiaojing.wang
8 months ago by
United States
xiaojing.wang50 wrote:
I have updated the package on release 3.7 and devl version. On Wed, Jun 27, 2018 at 4:19 PM, samupatt [bioc] <noreply@bioconductor.org> wrote: > Activity on a post you are following on support.bioconductor.org > > User samupatt <https: support.bioconductor.org="" u="" 16298=""/> wrote Question: > Error with PrepareAnnotationRefseq: "tablenametotrack2: UCSC table > "refGene" is not supported" <https: support.bioconductor.org="" p="" 110486=""/>: > > *Commands entered:* > > > > > library('customProDB') > > library('rtracklayer') > > session <- browserSession() > > genome(session) <- 'hg19' > > dbsnps <- trackNames(session)[grep('snp', trackNames(session), fixed=T)] > > > PrepareAnnotationRefseq(genome='hg19', CDSfasta="/home/shp12/UCSCData/refsequcsc.fasta", > pepfasta="/home/shp12/UCSCData/refpepucsc.fasta", > annotation_path="/home/shp12/Annotation_data") > > *Error obtained:* > > PrepareAnnotationRefseq(genome='hg19', CDSfasta="/home/shp12/UCSCData/refsequcsc.fasta", > pepfasta="/home/shp12/UCSCData/refpeBuild TranscriptDB object > (txdb.sqlite) ... nnotation_data") > > Error in .tablename2track(tablename, session) : > UCSC table "refGene" is not supported > > *sessionInfo()* > R version 3.4.1 (2017-06-30) > Platform: x86_64-pc-linux-gnu (64-bit) > Running under: CentOS Linux 7 (Core) > > Matrix products: default > BLAS/LAPACK: /n/app/openblas/0.2.19/lib/libopenblas_core2p-r0.2.19.so > > locale: > [1] LC_CTYPE=en_US.UTF-8 LC_NUMERIC=C > [3] LC_TIME=en_US.UTF-8 LC_COLLATE=en_US.UTF-8 > [5] LC_MONETARY=en_US.UTF-8 LC_MESSAGES=en_US.UTF-8 > [7] LC_PAPER=en_US.UTF-8 LC_NAME=C > [9] LC_ADDRESS=C LC_TELEPHONE=C > [11] LC_MEASUREMENT=en_US.UTF-8 LC_IDENTIFICATION=C > > attached base packages: > [1] stats4 parallel stats graphics grDevices utils datasets > [8] methods base > > other attached packages: > [1] customProDB_1.18.0 BiocInstaller_1.28.0 rtracklayer_1.38.3 > [4] GenomicRanges_1.30.3 GenomeInfoDb_1.14.0 biomaRt_2.34.2 > [7] AnnotationDbi_1.40.0 Biobase_2.38.0 IRanges_2.12.0 > [10] S4Vectors_0.16.0 BiocGenerics_0.24.0 > > loaded via a namespace (and not attached): > [1] Rcpp_0.12.17 plyr_1.8.4 > [3] compiler_3.4.1 XVector_0.18.0 > [5] GenomicFeatures_1.30.3 prettyunits_1.0.2 > [7] bitops_1.0-6 tools_3.4.1 > [9] progress_1.2.0 zlibbioc_1.24.0 > [11] digest_0.6.15 bit_1.1-14 > [13] AhoCorasickTrie_0.1.0 BSgenome_1.46.0 > [15] lattice_0.20-35 RSQLite_2.1.1 > [17] memoise_1.1.0 pkgconfig_2.0.1 > [19] rlang_0.2.1 Matrix_1.2-10 > [21] DelayedArray_0.4.1 DBI_1.0.0 > [23] GenomeInfoDbData_1.0.0 stringr_1.3.1 > [25] httr_1.3.1 Biostrings_2.46.0 > [27] hms_0.4.2 grid_3.4.1 > [29] bit64_0.9-7 R6_2.2.2 > [31] RMySQL_0.10.15 XML_3.98-1.11 > [33] BiocParallel_1.12.0 blob_1.1.1 > [35] magrittr_1.5 matrixStats_0.53.1 > [37] GenomicAlignments_1.14.2 Rsamtools_1.30.0 > [39] SummarizedExperiment_1.8.1 assertthat_0.2.0 > [41] stringi_1.2.3 RCurl_1.95-4.10 > [43] VariantAnnotation_1.24.5 crayon_1.3.4 > > > > *Head of Sequence and Peptide files in question:* > > Pep:>NP_001337147.1 > MMEGLKKRTRKAFGIRKKEKDTDSTGSPDRDGIKKSNGAPNGFYAEIDWE > RYNSPELDEEGYSIRPEEPGSTKGKHFYSSSESEEEEESHKKFNIKIKPL > QSKDILKNAATVDELKASIGNIALSPSPVRKSPRRSPGAIKRNLSSEEVA > > Seq: > >hg19_refGene_NM_001350218 range=chr1:67000042-67208778 5'pad=0 3'pad=0 > strand=+ repeatMasking=none > ATGATGGAAGGATTGAAAAAACGTACAAGGAAGGCCTTTGGAATACGGAA > GAAAGAAAAGGACACTGATTCTACAGGTTCACCAGATAGAGATGGAATTA > AGAAAAGCAATGGGGCACCAAATGGATTTTATGCGGAAATTGATTGGGAA > > > > ------------------------------ > > Post tags: customProDB > > You may reply via email or visit https://support.bioconductor. > org/p/110486/ >
ADD COMMENTlink written 8 months ago by xiaojing.wang50
Please log in to add an answer.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 16.09
Traffic: 111 users visited in the last hour