Error with PrepareAnnotationRefseq: "tablenametotrack2: UCSC table "refGene" is not supported"
1
0
Entering edit mode
samupatt • 0
@samupatt-16298
Last seen 4.4 years ago

Commands entered:

 

> library('customProDB')
> library('rtracklayer')
> session <- browserSession()
> genome(session) <- 'hg19'
> dbsnps <- trackNames(session)[grep('snp', trackNames(session), fixed=T)]

> PrepareAnnotationRefseq(genome='hg19', CDSfasta="/home/shp12/UCSCData/refsequcsc.fasta", pepfasta="/home/shp12/UCSCData/refpepucsc.fasta", annotation_path="/home/shp12/Annotation_data")

Error obtained:

PrepareAnnotationRefseq(genome='hg19', CDSfasta="/home/shp12/UCSCData/refsequcsc.fasta", pepfasta="/home/shp12/UCSCData/refpeBuild TranscriptDB object (txdb.sqlite) ... nnotation_data")

Error in .tablename2track(tablename, session) :
  UCSC table "refGene" is not supported

sessionInfo()
R version 3.4.1 (2017-06-30)
Platform: x86_64-pc-linux-gnu (64-bit)
Running under: CentOS Linux 7 (Core)

Matrix products: default
BLAS/LAPACK: /n/app/openblas/0.2.19/lib/libopenblas_core2p-r0.2.19.so

locale:
 [1] LC_CTYPE=en_US.UTF-8       LC_NUMERIC=C
 [3] LC_TIME=en_US.UTF-8        LC_COLLATE=en_US.UTF-8
 [5] LC_MONETARY=en_US.UTF-8    LC_MESSAGES=en_US.UTF-8
 [7] LC_PAPER=en_US.UTF-8       LC_NAME=C
 [9] LC_ADDRESS=C               LC_TELEPHONE=C
[11] LC_MEASUREMENT=en_US.UTF-8 LC_IDENTIFICATION=C

attached base packages:
[1] stats4    parallel  stats     graphics  grDevices utils     datasets
[8] methods   base

other attached packages:
 [1] customProDB_1.18.0   BiocInstaller_1.28.0 rtracklayer_1.38.3
 [4] GenomicRanges_1.30.3 GenomeInfoDb_1.14.0  biomaRt_2.34.2
 [7] AnnotationDbi_1.40.0 Biobase_2.38.0       IRanges_2.12.0
[10] S4Vectors_0.16.0     BiocGenerics_0.24.0

loaded via a namespace (and not attached):
 [1] Rcpp_0.12.17               plyr_1.8.4
 [3] compiler_3.4.1             XVector_0.18.0
 [5] GenomicFeatures_1.30.3     prettyunits_1.0.2
 [7] bitops_1.0-6               tools_3.4.1
 [9] progress_1.2.0             zlibbioc_1.24.0
[11] digest_0.6.15              bit_1.1-14
[13] AhoCorasickTrie_0.1.0      BSgenome_1.46.0
[15] lattice_0.20-35            RSQLite_2.1.1
[17] memoise_1.1.0              pkgconfig_2.0.1
[19] rlang_0.2.1                Matrix_1.2-10
[21] DelayedArray_0.4.1         DBI_1.0.0
[23] GenomeInfoDbData_1.0.0     stringr_1.3.1
[25] httr_1.3.1                 Biostrings_2.46.0
[27] hms_0.4.2                  grid_3.4.1
[29] bit64_0.9-7                R6_2.2.2
[31] RMySQL_0.10.15             XML_3.98-1.11
[33] BiocParallel_1.12.0        blob_1.1.1
[35] magrittr_1.5               matrixStats_0.53.1
[37] GenomicAlignments_1.14.2   Rsamtools_1.30.0
[39] SummarizedExperiment_1.8.1 assertthat_0.2.0
[41] stringi_1.2.3              RCurl_1.95-4.10
[43] VariantAnnotation_1.24.5   crayon_1.3.4
>

Head of Sequence and Peptide files in question:

Pep:>NP_001337147.1
MMEGLKKRTRKAFGIRKKEKDTDSTGSPDRDGIKKSNGAPNGFYAEIDWE
RYNSPELDEEGYSIRPEEPGSTKGKHFYSSSESEEEEESHKKFNIKIKPL
QSKDILKNAATVDELKASIGNIALSPSPVRKSPRRSPGAIKRNLSSEEVA

Seq:
>hg19_refGene_NM_001350218 range=chr1:67000042-67208778 5'pad=0 3'pad=0 strand=+ repeatMasking=none
ATGATGGAAGGATTGAAAAAACGTACAAGGAAGGCCTTTGGAATACGGAA
GAAAGAAAAGGACACTGATTCTACAGGTTCACCAGATAGAGATGGAATTA
AGAAAAGCAATGGGGCACCAAATGGATTTTATGCGGAAATTGATTGGGAA

 

customProDB • 539 views
ADD COMMENT
0
Entering edit mode
@xiaojingwang-8081
Last seen 4.3 years ago
United States
I have updated the package on release 3.7 and devl version. On Wed, Jun 27, 2018 at 4:19 PM, samupatt [bioc] <noreply@bioconductor.org> wrote: > Activity on a post you are following on support.bioconductor.org > > User samupatt <https: support.bioconductor.org="" u="" 16298=""/> wrote Question: > Error with PrepareAnnotationRefseq: "tablenametotrack2: UCSC table > "refGene" is not supported" <https: support.bioconductor.org="" p="" 110486=""/>: > > *Commands entered:* > > > > > library('customProDB') > > library('rtracklayer') > > session <- browserSession() > > genome(session) <- 'hg19' > > dbsnps <- trackNames(session)[grep('snp', trackNames(session), fixed=T)] > > > PrepareAnnotationRefseq(genome='hg19', CDSfasta="/home/shp12/UCSCData/refsequcsc.fasta", > pepfasta="/home/shp12/UCSCData/refpepucsc.fasta", > annotation_path="/home/shp12/Annotation_data") > > *Error obtained:* > > PrepareAnnotationRefseq(genome='hg19', CDSfasta="/home/shp12/UCSCData/refsequcsc.fasta", > pepfasta="/home/shp12/UCSCData/refpeBuild TranscriptDB object > (txdb.sqlite) ... nnotation_data") > > Error in .tablename2track(tablename, session) : > UCSC table "refGene" is not supported > > *sessionInfo()* > R version 3.4.1 (2017-06-30) > Platform: x86_64-pc-linux-gnu (64-bit) > Running under: CentOS Linux 7 (Core) > > Matrix products: default > BLAS/LAPACK: /n/app/openblas/0.2.19/lib/libopenblas_core2p-r0.2.19.so > > locale: > [1] LC_CTYPE=en_US.UTF-8 LC_NUMERIC=C > [3] LC_TIME=en_US.UTF-8 LC_COLLATE=en_US.UTF-8 > [5] LC_MONETARY=en_US.UTF-8 LC_MESSAGES=en_US.UTF-8 > [7] LC_PAPER=en_US.UTF-8 LC_NAME=C > [9] LC_ADDRESS=C LC_TELEPHONE=C > [11] LC_MEASUREMENT=en_US.UTF-8 LC_IDENTIFICATION=C > > attached base packages: > [1] stats4 parallel stats graphics grDevices utils datasets > [8] methods base > > other attached packages: > [1] customProDB_1.18.0 BiocInstaller_1.28.0 rtracklayer_1.38.3 > [4] GenomicRanges_1.30.3 GenomeInfoDb_1.14.0 biomaRt_2.34.2 > [7] AnnotationDbi_1.40.0 Biobase_2.38.0 IRanges_2.12.0 > [10] S4Vectors_0.16.0 BiocGenerics_0.24.0 > > loaded via a namespace (and not attached): > [1] Rcpp_0.12.17 plyr_1.8.4 > [3] compiler_3.4.1 XVector_0.18.0 > [5] GenomicFeatures_1.30.3 prettyunits_1.0.2 > [7] bitops_1.0-6 tools_3.4.1 > [9] progress_1.2.0 zlibbioc_1.24.0 > [11] digest_0.6.15 bit_1.1-14 > [13] AhoCorasickTrie_0.1.0 BSgenome_1.46.0 > [15] lattice_0.20-35 RSQLite_2.1.1 > [17] memoise_1.1.0 pkgconfig_2.0.1 > [19] rlang_0.2.1 Matrix_1.2-10 > [21] DelayedArray_0.4.1 DBI_1.0.0 > [23] GenomeInfoDbData_1.0.0 stringr_1.3.1 > [25] httr_1.3.1 Biostrings_2.46.0 > [27] hms_0.4.2 grid_3.4.1 > [29] bit64_0.9-7 R6_2.2.2 > [31] RMySQL_0.10.15 XML_3.98-1.11 > [33] BiocParallel_1.12.0 blob_1.1.1 > [35] magrittr_1.5 matrixStats_0.53.1 > [37] GenomicAlignments_1.14.2 Rsamtools_1.30.0 > [39] SummarizedExperiment_1.8.1 assertthat_0.2.0 > [41] stringi_1.2.3 RCurl_1.95-4.10 > [43] VariantAnnotation_1.24.5 crayon_1.3.4 > > > > *Head of Sequence and Peptide files in question:* > > Pep:>NP_001337147.1 > MMEGLKKRTRKAFGIRKKEKDTDSTGSPDRDGIKKSNGAPNGFYAEIDWE > RYNSPELDEEGYSIRPEEPGSTKGKHFYSSSESEEEEESHKKFNIKIKPL > QSKDILKNAATVDELKASIGNIALSPSPVRKSPRRSPGAIKRNLSSEEVA > > Seq: > >hg19_refGene_NM_001350218 range=chr1:67000042-67208778 5'pad=0 3'pad=0 > strand=+ repeatMasking=none > ATGATGGAAGGATTGAAAAAACGTACAAGGAAGGCCTTTGGAATACGGAA > GAAAGAAAAGGACACTGATTCTACAGGTTCACCAGATAGAGATGGAATTA > AGAAAAGCAATGGGGCACCAAATGGATTTTATGCGGAAATTGATTGGGAA > > > > ------------------------------ > > Post tags: customProDB > > You may reply via email or visit https://support.bioconductor. > org/p/110486/ >
ADD COMMENT

Login before adding your answer.

Traffic: 201 users visited in the last hour
Help About
FAQ
Access RSS
API
Stats

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.

Powered by the version 2.3.6