Question: Error with PrepareAnnotationRefseq: "tablenametotrack2: UCSC table "refGene" is not supported"
gravatar for samupatt
11 months ago by
samupatt0 wrote:

Commands entered:


> library('customProDB')
> library('rtracklayer')
> session <- browserSession()
> genome(session) <- 'hg19'
> dbsnps <- trackNames(session)[grep('snp', trackNames(session), fixed=T)]

> PrepareAnnotationRefseq(genome='hg19', CDSfasta="/home/shp12/UCSCData/refsequcsc.fasta", pepfasta="/home/shp12/UCSCData/refpepucsc.fasta", annotation_path="/home/shp12/Annotation_data")

Error obtained:

PrepareAnnotationRefseq(genome='hg19', CDSfasta="/home/shp12/UCSCData/refsequcsc.fasta", pepfasta="/home/shp12/UCSCData/refpeBuild TranscriptDB object (txdb.sqlite) ... nnotation_data")

Error in .tablename2track(tablename, session) :
  UCSC table "refGene" is not supported

R version 3.4.1 (2017-06-30)
Platform: x86_64-pc-linux-gnu (64-bit)
Running under: CentOS Linux 7 (Core)

Matrix products: default
BLAS/LAPACK: /n/app/openblas/0.2.19/lib/

 [1] LC_CTYPE=en_US.UTF-8       LC_NUMERIC=C
 [3] LC_TIME=en_US.UTF-8        LC_COLLATE=en_US.UTF-8
 [7] LC_PAPER=en_US.UTF-8       LC_NAME=C
 [9] LC_ADDRESS=C               LC_TELEPHONE=C

attached base packages:
[1] stats4    parallel  stats     graphics  grDevices utils     datasets
[8] methods   base

other attached packages:
 [1] customProDB_1.18.0   BiocInstaller_1.28.0 rtracklayer_1.38.3
 [4] GenomicRanges_1.30.3 GenomeInfoDb_1.14.0  biomaRt_2.34.2
 [7] AnnotationDbi_1.40.0 Biobase_2.38.0       IRanges_2.12.0
[10] S4Vectors_0.16.0     BiocGenerics_0.24.0

loaded via a namespace (and not attached):
 [1] Rcpp_0.12.17               plyr_1.8.4
 [3] compiler_3.4.1             XVector_0.18.0
 [5] GenomicFeatures_1.30.3     prettyunits_1.0.2
 [7] bitops_1.0-6               tools_3.4.1
 [9] progress_1.2.0             zlibbioc_1.24.0
[11] digest_0.6.15              bit_1.1-14
[13] AhoCorasickTrie_0.1.0      BSgenome_1.46.0
[15] lattice_0.20-35            RSQLite_2.1.1
[17] memoise_1.1.0              pkgconfig_2.0.1
[19] rlang_0.2.1                Matrix_1.2-10
[21] DelayedArray_0.4.1         DBI_1.0.0
[23] GenomeInfoDbData_1.0.0     stringr_1.3.1
[25] httr_1.3.1                 Biostrings_2.46.0
[27] hms_0.4.2                  grid_3.4.1
[29] bit64_0.9-7                R6_2.2.2
[31] RMySQL_0.10.15             XML_3.98-1.11
[33] BiocParallel_1.12.0        blob_1.1.1
[35] magrittr_1.5               matrixStats_0.53.1
[37] GenomicAlignments_1.14.2   Rsamtools_1.30.0
[39] SummarizedExperiment_1.8.1 assertthat_0.2.0
[41] stringi_1.2.3              RCurl_1.95-4.10
[43] VariantAnnotation_1.24.5   crayon_1.3.4

Head of Sequence and Peptide files in question:


>hg19_refGene_NM_001350218 range=chr1:67000042-67208778 5'pad=0 3'pad=0 strand=+ repeatMasking=none


customprodb • 203 views
ADD COMMENTlink modified 10 months ago by xiaojing.wang50 • written 11 months ago by samupatt0
Answer: Error with PrepareAnnotationRefseq: "tablenametotrack2: UCSC table "refGene" is
gravatar for
10 months ago by
United States
xiaojing.wang50 wrote:
I have updated the package on release 3.7 and devl version. On Wed, Jun 27, 2018 at 4:19 PM, samupatt [bioc] <> wrote: > Activity on a post you are following on > > User samupatt <https:"" u="" 16298=""/> wrote Question: > Error with PrepareAnnotationRefseq: "tablenametotrack2: UCSC table > "refGene" is not supported" <https:"" p="" 110486=""/>: > > *Commands entered:* > > > > > library('customProDB') > > library('rtracklayer') > > session <- browserSession() > > genome(session) <- 'hg19' > > dbsnps <- trackNames(session)[grep('snp', trackNames(session), fixed=T)] > > > PrepareAnnotationRefseq(genome='hg19', CDSfasta="/home/shp12/UCSCData/refsequcsc.fasta", > pepfasta="/home/shp12/UCSCData/refpepucsc.fasta", > annotation_path="/home/shp12/Annotation_data") > > *Error obtained:* > > PrepareAnnotationRefseq(genome='hg19', CDSfasta="/home/shp12/UCSCData/refsequcsc.fasta", > pepfasta="/home/shp12/UCSCData/refpeBuild TranscriptDB object > (txdb.sqlite) ... nnotation_data") > > Error in .tablename2track(tablename, session) : > UCSC table "refGene" is not supported > > *sessionInfo()* > R version 3.4.1 (2017-06-30) > Platform: x86_64-pc-linux-gnu (64-bit) > Running under: CentOS Linux 7 (Core) > > Matrix products: default > BLAS/LAPACK: /n/app/openblas/0.2.19/lib/ > > locale: > [1] LC_CTYPE=en_US.UTF-8 LC_NUMERIC=C > [3] LC_TIME=en_US.UTF-8 LC_COLLATE=en_US.UTF-8 > [5] LC_MONETARY=en_US.UTF-8 LC_MESSAGES=en_US.UTF-8 > [7] LC_PAPER=en_US.UTF-8 LC_NAME=C > [9] LC_ADDRESS=C LC_TELEPHONE=C > [11] LC_MEASUREMENT=en_US.UTF-8 LC_IDENTIFICATION=C > > attached base packages: > [1] stats4 parallel stats graphics grDevices utils datasets > [8] methods base > > other attached packages: > [1] customProDB_1.18.0 BiocInstaller_1.28.0 rtracklayer_1.38.3 > [4] GenomicRanges_1.30.3 GenomeInfoDb_1.14.0 biomaRt_2.34.2 > [7] AnnotationDbi_1.40.0 Biobase_2.38.0 IRanges_2.12.0 > [10] S4Vectors_0.16.0 BiocGenerics_0.24.0 > > loaded via a namespace (and not attached): > [1] Rcpp_0.12.17 plyr_1.8.4 > [3] compiler_3.4.1 XVector_0.18.0 > [5] GenomicFeatures_1.30.3 prettyunits_1.0.2 > [7] bitops_1.0-6 tools_3.4.1 > [9] progress_1.2.0 zlibbioc_1.24.0 > [11] digest_0.6.15 bit_1.1-14 > [13] AhoCorasickTrie_0.1.0 BSgenome_1.46.0 > [15] lattice_0.20-35 RSQLite_2.1.1 > [17] memoise_1.1.0 pkgconfig_2.0.1 > [19] rlang_0.2.1 Matrix_1.2-10 > [21] DelayedArray_0.4.1 DBI_1.0.0 > [23] GenomeInfoDbData_1.0.0 stringr_1.3.1 > [25] httr_1.3.1 Biostrings_2.46.0 > [27] hms_0.4.2 grid_3.4.1 > [29] bit64_0.9-7 R6_2.2.2 > [31] RMySQL_0.10.15 XML_3.98-1.11 > [33] BiocParallel_1.12.0 blob_1.1.1 > [35] magrittr_1.5 matrixStats_0.53.1 > [37] GenomicAlignments_1.14.2 Rsamtools_1.30.0 > [39] SummarizedExperiment_1.8.1 assertthat_0.2.0 > [41] stringi_1.2.3 RCurl_1.95-4.10 > [43] VariantAnnotation_1.24.5 crayon_1.3.4 > > > > *Head of Sequence and Peptide files in question:* > > Pep:>NP_001337147.1 > MMEGLKKRTRKAFGIRKKEKDTDSTGSPDRDGIKKSNGAPNGFYAEIDWE > RYNSPELDEEGYSIRPEEPGSTKGKHFYSSSESEEEEESHKKFNIKIKPL > QSKDILKNAATVDELKASIGNIALSPSPVRKSPRRSPGAIKRNLSSEEVA > > Seq: > >hg19_refGene_NM_001350218 range=chr1:67000042-67208778 5'pad=0 3'pad=0 > strand=+ repeatMasking=none > ATGATGGAAGGATTGAAAAAACGTACAAGGAAGGCCTTTGGAATACGGAA > GAAAGAAAAGGACACTGATTCTACAGGTTCACCAGATAGAGATGGAATTA > AGAAAAGCAATGGGGCACCAAATGGATTTTATGCGGAAATTGATTGGGAA > > > > ------------------------------ > > Post tags: customProDB > > You may reply via email or visit https://support.bioconductor. > org/p/110486/ >
ADD COMMENTlink written 10 months ago by xiaojing.wang50
Please log in to add an answer.


Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 16.09
Traffic: 308 users visited in the last hour