Question: converting amino-acid one letter code into cDNA sequene
0
gravatar for arvind90.psc
3.5 years ago by
arvind90.psc0 wrote:

Somebody PleaseĀ help me in converting the below-mentioned amino acid one letter code into cDNA sequence. Kindly mention all the necessary steps regarding the same as I am new to R.

>tr|A0A091EJ74|A0A091EJ74_CORBR Gallinacin-9 (Fragment) OS=Corvus

brachyrhynchos GN=N302_05107 PE=4 SV=1

AYSQEASDTLACRQSRGSCSFVPCSAPLVEIGTCRGGKLRCCKW

ADD COMMENTlink written 3.5 years ago by arvind90.psc0
1

Well it's easier to convert a DNA sequence into protein sequence.

Here you will face a problem, caused by the Genetic Code redundancy (see https://en.wikipedia.org/wiki/Genetic_code#RNA_codon_table)

In other words, one amino acide can be coded by different DNA codons.

Thus, if you want to create code, you either chose one codon/amino acid, but then you are almost certain that your sequence will have no biological significance as it will not be the one in the Corvus DNA. Or you create every possibles sequences derived from it, but then you will have a lot of choices.

So the simplest answer to your question is : Why not searching if this gene has been sequenced ? (Spoiler alert : it has been)

ADD REPLYlink written 3.5 years ago by giroudpaul40
Please log in to add an answer.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 16.09
Traffic: 404 users visited in the last hour