Search
Question: Biostrings translate() function with alternative genetic code is not working for first codon
0
gravatar for atisou
7 days ago by
atisou0
Switzerland
atisou0 wrote:

Hello,

I would like to translate a bacterial DNA sequence into a protein using the GENETIC_CODE Id 11 (instead of the Standard Id 1) and below are the commands used:

dna <- "TTGAGGATGACGAATCGTAACGTCGAATGGACTGATAATGCCTGGGATGAATATATCTATTGGCAGACACAGGATAAAAAGATACTTAAGCGTATTAATACCTTAATCAAAGAATGTCAGCGAACACCTTTTGAAGGAACAGGAAAACCAGAACCTTTAAAAGCTAATCTTTCAGGATTTTGGAGTCGTAGGATTGATGAAAAGCATAGATTAGTTTATGAAGTGACAGATGAACGAATCTCTATAATTCAATGTCGATTCCATTACTAA"

dna_obj <- DNAString(dna, start = 1)

translate(dna_obj, genetic.code = getGeneticCode("11", full.search = FALSE))

  90-letter "AAString" instance
seq: LRMTNRNVEWTDNAWDEYIYWQTQDKKILKRINTLIKECQRTPFEGTGKPEPLKANLSGFWSRRIDEKHRLVYEVTDERISIIQCRFHY*

The 1st residue should be a Methionine, and not a Leucine as returned by translate(). The genetic code 11 translates as M the TTG codon (and also few others) if this one is located as the 1st codon in the sequence.

See the NCBI reference genetic code for the alternative codons usage in GENETIC_CODE 11:

https://www.ncbi.nlm.nih.gov/Taxonomy/Utils/wprintgc.cgi#SG11

Am I missing a parameter/option somewhere to make the selected GENETIC_CODE work properly? or is translate() not designed to take into account the codons positions for amino-acid assignments?

Hatice

 

ps: Thanks for making this great package available to the community!

 

 

 

 

 

 

ADD COMMENTlink modified 18 hours ago by Hervé Pagès ♦♦ 12k • written 7 days ago by atisou0
0
gravatar for Hervé Pagès
18 hours ago by
Hervé Pagès ♦♦ 12k
United States
Hervé Pagès ♦♦ 12k wrote:

Hi Hatice,

Thanks for pointing out this problem. It's true that translate() was not designed to take into account the codons positions for amino-acid assignments so the 1st codon in the sequence is not treated in any special way. Supporting this requires some change to the translate() interface, as well as (possibly) changes to GENETIC_CODE_TABLE and getGeneticCode(). I'm going to look into this and will let you know.

Best,

H.

ADD COMMENTlink written 18 hours ago by Hervé Pagès ♦♦ 12k
Please log in to add an answer.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.2.0
Traffic: 257 users visited in the last hour