User: Ou, Jianhong

gravatar for Ou, Jianhong
Ou, Jianhong1.1k
Reputation:
1,140
Status:
Trusted
Location:
United States
Last seen:
4 weeks ago
Joined:
8 years, 3 months ago
Email:
j**********@duke.edu

Posts by Ou, Jianhong

<prev • 164 results • page 1 of 17 • next >
0
votes
1
answer
110
views
1
answers
Comment: C: atacseqQC error while splittin the bamfile
... Hi, Have a try with newest version of ATACseqQC. The error should be handled by the program. Jianhong. ...
written 28 days ago by Ou, Jianhong1.1k
0
votes
1
answer
110
views
1
answers
Answer: A: atacseqQC error while splittin the bamfile
... Hi, Could you share me the bamfile which can repeat the error? Jianhong. From: "theodore.georgomanolis [bioc]" noreply@bioconductor.org Reply-To: "reply+316c39ef+code@bioconductor.org" <reply+316c39ef+code@bioconductor.org> Date: Sunday, May 5, 2019 at 10:22 AM To: "Jianhong Ou, Ph.D." jian ...
written 6 weeks ago by Ou, Jianhong1.1k
0
votes
3
answers
81
views
3
answers
Comment: C: chippeakanno file reading error
... you have typo, change brg1bed to brg1.bed for more information please refer:https://cran.r-project.org/doc/contrib/Paradis-rdebuts_en.pdf ...
written 11 weeks ago by Ou, Jianhong1.1k
0
votes
3
answers
81
views
3
answers
Answer: A: chippeakanno file reading error
... suppose your brg1.bed is in current working directory, please try to run: grbrg1 <- toGRanges("brg1.bed", format="BED", header=FALSE) ...
written 11 weeks ago by Ou, Jianhong1.1k
1
vote
1
answer
75
views
1
answers
Answer: A: how can I convert a sequence to number
... Is this a good way to show your sequence as a motif logo? It is not suggested. Whatever, you can try following code to plot your sequence. seq <- "MGLRYSIYIENPLSSPSSSYKSINDPLFHSQHRSQKNVSFITYGCRHCKTHLSSSFQIIS RDYRGRTGTAYLMNKVVNVVEGKVEQRRMLTGDYLVCDILCHWCKRNVGWKYLQSSNDDQ QYKEGKFILELKNI ...
written 12 weeks ago by Ou, Jianhong1.1k
0
votes
1
answer
726
views
1
answers
Comment: C: motifStack crashes for example from documentation
... Hi Zixi, Great to know you figure it out! Jianhong ...
written 3 months ago by Ou, Jianhong1.1k
0
votes
1
answer
726
views
1
answers
Comment: C: motifStack crashes for example from documentation
... Hi Zixi, Sorry for the late reply. I tried to repeat your error in centOS 6.10 (docker to centOS 6.6 is not working). However I can not repeat it. I think main issue may be caused by the library of libxml2-devel or curl-devel. You can have a try to reinstall the grImport by giving it correct libxml ...
written 3 months ago by Ou, Jianhong1.1k
0
votes
1
answer
726
views
1
answers
Comment: C: motifStack crashes for example from documentation
... Hi chenzixi, Thank you for confirm this segment fault agian. Could you try to re-install grImport from source like this: install.packages("grImport", type="source") and then re-run the code above. Before you run pic <- readPicture(paste0(tmp, ".xml")), could you please run sessionInfo() and s ...
written 3 months ago by Ou, Jianhong1.1k
0
votes
0
answers
141
views
0
answers
Comment: C: how does "maxgap" in ChIPpeakAnno working?
... "both" means it will include all the results of nearestLocation and overlapping. I understand that this is a little confusion. ...
written 4 months ago by Ou, Jianhong1.1k
1
vote
2
answers
160
views
2
answers
Answer: A: The meaning of results produced by the bamQC function implemented in the ATACseq
... Hi Gary, (1) The meaning of $totalQNAMEs Total number of reads (single, paired) (3) The meaning of $MAPQ. Is it mapping quality? Yes. It is the count of each mapping quality value. (4) How does ATACseqQC define the low mapping quality in $notPassingQualityControlsRate ATACseqQC did not define the ...
written 4 months ago by Ou, Jianhong1.1k

Latest awards to Ou, Jianhong

Popular Question 9 months ago, created a question with more than 1,000 views. For howto plot a figure like UCSC genome browser by Gviz
Popular Question 11 months ago, created a question with more than 1,000 views. For howto plot a figure like UCSC genome browser by Gviz
Scholar 24 months ago, created an answer that has been accepted. For A: org.Mm.eg.db mm9 version for ChIPpeakAnno getEnrichedGO function
Scholar 24 months ago, created an answer that has been accepted. For A: Curious behaviour of ChIPpeakAnno
Popular Question 24 months ago, created a question with more than 1,000 views. For howto plot a figure like UCSC genome browser by Gviz
Scholar 24 months ago, created an answer that has been accepted. For A: How to fix ChIPPeakAnno error in adding gene names to annotated peaks?
Scholar 24 months ago, created an answer that has been accepted. For A: Curious behaviour of ChIPpeakAnno
Teacher 24 months ago, created an answer with at least 3 up-votes. For A: Annotation Database for ChIPpeakAnno
Scholar 2.2 years ago, created an answer that has been accepted. For A: Curious behaviour of ChIPpeakAnno
Scholar 3.3 years ago, created an answer that has been accepted. For A: Curious behaviour of ChIPpeakAnno
Teacher 3.3 years ago, created an answer with at least 3 up-votes. For A: How to fix ChIPPeakAnno error in adding gene names to annotated peaks?
Centurion 3.3 years ago, created 100 posts.
Scholar 3.6 years ago, created an answer that has been accepted. For A: org.Mm.eg.db mm9 version for ChIPpeakAnno getEnrichedGO function
Scholar 4.6 years ago, created an answer that has been accepted. For A: Curious behaviour of ChIPpeakAnno

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 16.09
Traffic: 361 users visited in the last hour