Search
Question: Pbase: AddIdentificationData. How can I use MSnId objects (filtered psm) to build the Proteins database
0
gravatar for viswanathan.raghuram
2.8 years ago by
viswanathan.raghuram0 wrote:

I would like to build my Proteins database using the mzid files filtered by MsnId. Can you somebody please help me. Is it possible to add identifications from as a data.frame

Thanks

Viswanathan Raghuram

ADD COMMENTlink modified 2.8 years ago by Sebastian Gibb80 • written 2.8 years ago by viswanathan.raghuram0

Could you clarify what you are trying to do. Once you have a subset of proteins that you deem relevant, what do you want to do; where to you want to add identifications to?

ADD REPLYlink written 2.8 years ago by Laurent Gatto1.0k

I have multiple mzID files, which I can combine and filter  by MSnId.  I would like to create a 'Proteins' object and  map the identified peptides back to the genome. Currently, I can create a 'Proteins' object and add the identified peptides in one 'mzID or more 'mzID' files, via 

p <- addIdentificationData(p, idfile), 

However these are unfiltered and multiple mzid file creates a separate maps rather than a combined one.

Thanks

VR

ADD REPLYlink written 2.8 years ago by viswanathan.raghuram0
0
gravatar for Laurent Gatto
2.8 years ago by
Laurent Gatto1.0k
United Kingdom
Laurent Gatto1.0k wrote:

My suggestion would be to do the following (not tested though): using MSnID, calculate the filters to obtain your desired FDR, record the values and then apply them directly on the Proteins object. Something like

library("Pbase")
data(p) ## example data
delta <- pcols(p)[, "experimentalMassToCharge"] -
    pcols(p)[, "calculatedMassToCharge"]
lengths(pranges(p))
## assuming MSnID suggested a delta of 0.35
sel <- abs(delta) < 0.35
pranges(p) <- pranges(p)[sel]
lengths(pranges(p))

Note that you will need to install the latest version (0.11.3) from github:

biocLite("ComputationalProteomicsUnit/Pbase")

 

 

ADD COMMENTlink written 2.8 years ago by Laurent Gatto1.0k

Thanks.

I will try this

ADD REPLYlink written 2.8 years ago by viswanathan.raghuram0
0
gravatar for viswanathan.raghuram
2.8 years ago by
viswanathan.raghuram0 wrote:

Unable to install  the latest version

----------------------------------------------------------

> library("devtools")
> install_github("ComputationalProteomicsUnit/Pbase")
Downloading GitHub repo ComputationalProteomicsUnit/Pbase@master
from URL https://api.github.com/repos/ComputationalProteomicsUnit/Pbase/zipball/master
Installing Pbase
Skipping 1 package ahead of CRAN: ggplot2
"C:/PROGRA~1/R/R-devel/bin/x64/R" --no-site-file --no-environ --no-save --no-restore CMD  \
  INSTALL  \
  "C:/Users/Viswanathan/AppData/Local/Temp/RtmpSSoTcF/devtools39ea43b975fa1/ComputationalProteomicsUnit-Pbase-9e90914"  \
  --library="C:/Users/Viswanathan/Documents/R/win-library/3.3" --install-tests 

* installing *source* package 'Pbase' ...
** R
Error in parse(outFile) : 
  C:/Users/Viswanathan/AppData/Local/Temp/RtmpSSoTcF/devtools39ea43b975fa1/ComputationalProteomicsUnit-Pbase-9e90914/R/Proteins:201:9: unexpected symbol
200:     if (!identical(names(object@pranges, names(values)))
201:         stop
             ^
ERROR: unable to collate and parse R files for package 'Pbase'
* removing 'C:/Users/Viswanathan/Documents/R/win-library/3.3/Pbase'
* restoring previous 'C:/Users/Viswanathan/Documents/R/win-library/3.3/Pbase'
Error: Command failed (1)

> session_info()
Session info ------------------------------------------------------------------------------------
 setting  value                                             
 version  R Under development (unstable) (2016-02-25 r70222)
 system   x86_64, mingw32                                   
 ui       RStudio (0.99.484)                                
 language (EN)                                              
 collate  English_United States.1252                        
 tz       America/New_York                                  
 date     2016-03-01                                        

Packages ----------------------------------------------------------------------------------------
 package       * version date       source        
 Biobase         2.31.3  2015-12-22 Bioconductor  
 BiocGenerics    0.17.3  2016-01-29 Bioconductor  
 BiocInstaller   1.21.3  2016-01-21 Bioconductor  
 codetools       0.2-14  2015-07-15 CRAN (R 3.3.0)
 curl            0.9.6   2016-02-17 CRAN (R 3.3.0)
 devtools      * 1.10.0  2016-01-23 CRAN (R 3.3.0)
 digest          0.6.9   2016-01-08 CRAN (R 3.3.0)
 git2r           0.13.1  2015-12-10 CRAN (R 3.3.0)
 httr            1.1.0   2016-01-28 CRAN (R 3.3.0)
 memoise         1.0.0   2016-01-29 CRAN (R 3.3.0)
 mzR             2.5.3   2016-02-25 Bioconductor  
 ProtGenerics    1.3.3   2015-10-20 Bioconductor  
 R6              2.1.2   2016-01-26 CRAN (R 3.3.0)
 Rcpp            0.12.3  2016-01-10 CRAN (R 3.3.0)
 withr           1.0.1   2016-02-04 CRAN (R 3.3.0)

ADD COMMENTlink written 2.8 years ago by viswanathan.raghuram0

Fixed - try again now

ADD REPLYlink written 2.8 years ago by Laurent Gatto1.0k

Unable to subset pranges(p)

> data(p)
> length(pranges(p))
[1] 9
> lengths(pranges(p))
  A4UGR9   A6H8Y1   O43707   O75369   P00558   P02545   P04075 P04075-2   P60709 
      36       23        6       13        5       12       21       20        1 
> delta <- pcols(p)[, "experimentalMassToCharge"] -
+ pcols(p)[, "calculatedMassToCharge"]
> sel <- abs(delta) < 0.35
> sel
LogicalList of length 9
[["A4UGR9"]] TRUE FALSE TRUE FALSE TRUE TRUE TRUE FALSE TRUE ... TRUE TRUE TRUE FALSE FALSE FALSE TRUE TRUE
[["A6H8Y1"]] TRUE FALSE TRUE TRUE FALSE TRUE TRUE TRUE TRUE ... TRUE TRUE FALSE TRUE TRUE TRUE TRUE FALSE TRUE
[["O43707"]] TRUE FALSE TRUE TRUE TRUE TRUE
[["O75369"]] TRUE TRUE TRUE TRUE TRUE FALSE FALSE TRUE TRUE TRUE TRUE TRUE FALSE
[["P00558"]] FALSE FALSE TRUE FALSE FALSE
[["P02545"]] FALSE TRUE TRUE FALSE TRUE TRUE TRUE TRUE TRUE TRUE FALSE FALSE
[["P04075"]] FALSE TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE ... TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE
[["P04075-2"]] FALSE TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE ... TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE
[["P60709"]] TRUE
> pranges(p) <- pranges(p)[sel]
Error in names(object@pranges, names(values)) : 
  2 arguments passed to 'names' which requires 1
> lengths(pranges(p))
  A4UGR9   A6H8Y1   O43707   O75369   P00558   P02545   P04075 P04075-2   P60709 
      36       23        6       13        5       12       21       20        1 
> session_info()
Session info ---------------------------------------------------------------------------------------------------
 setting  value                                             
 version  R Under development (unstable) (2016-02-25 r70222)
 system   x86_64, mingw32                                   
 ui       RStudio (0.99.484)                                
 language (EN)                                              
 collate  English_United States.1252                        
 tz       America/New_York                                  
 date     2016-03-05                                        

Packages -------------------------------------------------------------------------------------------------------
 package                * version  date       source                                            
 acepack                  1.3-3.3  2014-11-24 CRAN (R 3.3.0)                                    
 affy                     1.49.0   2015-10-14 Bioconductor                                      
 affyio                   1.41.0   2015-10-14 Bioconductor                                      
 AnnotationDbi            1.33.7   2016-01-29 Bioconductor                                      
 AnnotationHub            2.3.14   2016-03-04 Bioconductor                                      
 Biobase                  2.31.3   2015-12-22 Bioconductor                                      
 BiocGenerics           * 0.17.3   2016-01-29 Bioconductor                                      
 BiocInstaller            1.21.3   2016-01-21 Bioconductor                                      
 BiocParallel             1.5.19   2016-03-03 Bioconductor                                      
 biomaRt                  2.27.2   2015-11-24 Bioconductor                                      
 Biostrings               2.39.12  2016-02-21 Bioconductor                                      
 biovizBase               1.19.4   2016-02-22 Bioconductor                                      
 bitops                   1.0-6    2013-08-17 CRAN (R 3.3.0)                                    
 BSgenome                 1.39.4   2016-02-21 Bioconductor                                      
 chron                    2.3-47   2015-06-24 CRAN (R 3.3.0)                                    
 cleaver                  1.9.0    2015-10-14 Bioconductor                                      
 cluster                  2.0.3    2015-07-21 CRAN (R 3.3.0)                                    
 codetools                0.2-14   2015-07-15 CRAN (R 3.3.0)                                    
 colorspace               1.2-6    2015-03-11 CRAN (R 3.3.0)                                    
 curl                     0.9.6    2016-02-17 CRAN (R 3.3.0)                                    
 data.table               1.9.6    2015-09-19 CRAN (R 3.3.0)                                    
 DBI                      0.3.1    2014-09-24 CRAN (R 3.3.0)                                    
 devtools               * 1.10.0   2016-01-23 CRAN (R 3.3.0)                                    
 dichromat                2.0-0    2013-01-24 CRAN (R 3.3.0)                                    
 digest                   0.6.9    2016-01-08 CRAN (R 3.3.0)                                    
 doParallel               1.0.10   2015-10-14 CRAN (R 3.3.0)                                    
 ensembldb                1.3.17   2016-02-22 Bioconductor                                      
 foreach                  1.4.3    2015-10-13 CRAN (R 3.3.0)                                    
 foreign                  0.8-66   2015-08-19 CRAN (R 3.3.0)                                    
 Formula                  1.2-1    2015-04-07 CRAN (R 3.3.0)                                    
 GenomeInfoDb           * 1.7.6    2016-01-29 Bioconductor                                      
 GenomicAlignments        1.7.20   2016-02-25 Bioconductor                                      
 GenomicFeatures          1.23.25  2016-02-25 Bioconductor                                      
 GenomicRanges          * 1.23.23  2016-02-25 Bioconductor                                      
 ggplot2                  2.1.0    2016-03-01 CRAN (R 3.3.0)                                    
 git2r                    0.13.1   2015-12-10 CRAN (R 3.3.0)                                    
 gridExtra                2.2.1    2016-02-29 CRAN (R 3.3.0)                                    
 gtable                   0.2.0    2016-02-26 CRAN (R 3.3.0)                                    
 Gviz                   * 1.15.4   2016-02-18 Bioconductor                                      
 Hmisc                    3.17-2   2016-02-21 CRAN (R 3.3.0)                                    
 htmltools                0.3      2015-12-29 CRAN (R 3.3.0)                                    
 httpuv                   1.3.3    2015-08-04 CRAN (R 3.3.0)                                    
 httr                     1.1.0    2016-01-28 CRAN (R 3.3.0)                                    
 impute                   1.45.0   2015-10-14 Bioconductor                                      
 interactiveDisplayBase   1.9.0    2015-10-14 Bioconductor                                      
 IRanges                * 2.5.39   2016-02-28 Bioconductor                                      
 iterators                1.0.8    2015-10-13 CRAN (R 3.3.0)                                    
 lattice                  0.20-33  2015-07-14 CRAN (R 3.3.0)                                    
 latticeExtra             0.6-28   2016-02-09 CRAN (R 3.3.0)                                    
 limma                    3.27.13  2016-03-02 Bioconductor                                      
 magrittr                 1.5      2014-11-22 CRAN (R 3.3.0)                                    
 MALDIquant               1.14     2015-11-18 CRAN (R 3.3.0)                                    
 matrixStats              0.50.1   2015-12-15 CRAN (R 3.3.0)                                    
 memoise                  1.0.0    2016-01-29 CRAN (R 3.3.0)                                    
 mime                     0.4      2015-09-03 CRAN (R 3.3.0)                                    
 MSnbase                  1.19.11  2016-02-04 Bioconductor                                      
 munsell                  0.4.3    2016-02-13 CRAN (R 3.3.0)                                    
 mzID                     1.9.0    2015-10-14 Bioconductor                                      
 mzR                      2.5.3    2016-02-25 Bioconductor                                      
 nnet                     7.3-12   2016-02-02 CRAN (R 3.3.0)                                    
 Pbase                  * 0.11.3   2016-03-05 Github (ComputationalProteomicsUnit/Pbase@b4c4955)
 pcaMethods               1.63.0   2016-01-17 Bioconductor                                      
 plyr                     1.8.3    2015-06-12 CRAN (R 3.3.0)                                    
 preprocessCore           1.33.0   2015-10-14 Bioconductor                                      
 ProtGenerics             1.3.3    2015-10-20 Bioconductor                                      
 Pviz                     1.5.0    2015-10-14 Bioconductor                                      
 R6                       2.1.2    2016-01-26 CRAN (R 3.3.0)                                    
 RColorBrewer             1.1-2    2014-12-07 CRAN (R 3.3.0)                                    
 Rcpp                   * 0.12.3   2016-01-10 CRAN (R 3.3.0)                                    
 RCurl                    1.95-4.8 2016-03-01 CRAN (R 3.3.0)                                    
 reshape2                 1.4.1    2014-12-06 CRAN (R 3.3.0)                                    
 rpart                    4.1-10   2015-06-29 CRAN (R 3.3.0)                                    
 Rsamtools                1.23.3   2016-01-25 Bioconductor                                      
 RSQLite                  1.0.0    2014-10-25 CRAN (R 3.3.0)                                    
 rtracklayer              1.31.7   2016-02-16 Bioconductor                                      
 S4Vectors              * 0.9.40   2016-02-25 Bioconductor                                      
 scales                   0.4.0    2016-02-26 CRAN (R 3.3.0)                                    
 shiny                    0.13.1   2016-02-17 CRAN (R 3.3.0)                                    
 stringi                  1.0-1    2015-10-22 CRAN (R 3.3.0)                                    
 stringr                  1.0.0    2015-04-30 CRAN (R 3.3.0)                                    
 SummarizedExperiment     1.1.21   2016-02-25 Bioconductor                                      
 survival                 2.38-3   2015-07-02 CRAN (R 3.3.0)                                    
 VariantAnnotation        1.17.18  2016-01-29 Bioconductor                                      
 vsn                      3.39.2   2016-01-06 Bioconductor                                      
 withr                    1.0.1    2016-02-04 CRAN (R 3.3.0)                                    
 XML                      3.98-1.4 2016-03-01 CRAN (R 3.3.0)                                    
 xtable                   1.8-2    2016-02-05 CRAN (R 3.3.0)                                    
 XVector                  0.11.7   2016-02-13 Bioconductor                                      
 zlibbioc                 1.17.0   2015-10-14 Bioconductor

ADD REPLYlink written 2.8 years ago by viswanathan.raghuram0

Here we go again. There will be more changes in the coming days, so better (for now) use a specific commit.

install_github("ComputationalProteomicsUnit/Pbase",
               ref = "#6eb74a307f8cc6705df3b758bb74ec691689f1f0")

Once all tests have been added, I will commit to Bioc.

EDIT: please now rather use the official version 0.11.3 from Bioconductor.

ADD REPLYlink modified 2.8 years ago • written 2.8 years ago by Laurent Gatto1.0k

I have just pushed to Bioconductor - version 0.11.3 (devel) that contains pranges<- and acols<- replacement methods should become available in about 24 hours.

 

ADD REPLYlink written 2.8 years ago by Laurent Gatto1.0k

It works for the example data set,but not for my dataset. I get the following error. 

Error in replacePranges(object, value) : 
  Names of replacement pranges differ from current ones.

> library("Pbase")
Loading required package: BiocGenerics
Loading required package: parallel

Attaching package: ‘BiocGenerics’

The following objects are masked from ‘package:parallel’:

    clusterApply, clusterApplyLB, clusterCall, clusterEvalQ, clusterExport,
    clusterMap, parApply, parCapply, parLapply, parLapplyLB, parRapply,
    parSapply, parSapplyLB

The following objects are masked from ‘package:stats’:

    IQR, mad, xtabs

The following objects are masked from ‘package:base’:

    anyDuplicated, append, as.data.frame, cbind, colnames, do.call, duplicated,
    eval, evalq, Filter, Find, get, grep, grepl, intersect, is.unsorted, lapply,
    lengths, Map, mapply, match, mget, order, paste, pmax, pmax.int, pmin,
    pmin.int, Position, rank, rbind, Reduce, rownames, sapply, setdiff, sort,
    table, tapply, union, unique, unsplit

Loading required package: Rcpp
Loading required package: Gviz
Loading required package: S4Vectors
Loading required package: stats4

Attaching package: ‘S4Vectors’

The following object is masked from ‘package:base’:

    expand.grid

Loading required package: IRanges
Loading required package: GenomicRanges
Loading required package: GenomeInfoDb
Loading required package: grid

This is Pbase version 0.11.3

> setwd("D:/Proteins_DB")
> p <- readRDS("p.test.Ptn")
> p
S4 class type     : Proteins
Class version     : 0.1
Created           : Tue Feb  9 14:26:29 2016
Number of Proteins: 10
Sequences:
  [1] Q9Z2K1 [2] Q3SYP5 ... [9] D3Z765 [10] Q61781
Sequence features:
  [1] DB [2] AccessionNumber ... [11] Filename [12] npeps
Peptide features:
  [1] DB [2] AccessionNumber ... [27] acquisitionNum [28] filenames
> aa(p)
  A AAStringSet instance of length 10
     width seq                                                          names               
 [1]   469 MATCSRQFTSSSSMKGSCGIGGGSSRMSS...SSSRQPRSILKEQGSTSFSQSQSQSSRD Q9Z2K1
 [2]   469 MATCSRQFTSSSSMKGSCGIGGGSSRMSS...SSSRQPRSILKEQGSTSFSQSQSQSSRD Q3SYP5
 [3]  2703 MYNGIGLPTPRGSGTNGYVQRNLSLVRGR...RGDSHSPGHKRKETPSPRSNRHRSSRSP Q8BTI8
 [4]   432 MISAAQLLDELMGRDRNLAPDEKRSNVRW...PESKESDTKNEVNGTSEDIKSEGDTQSN Q5SUF2
 [5]   707 MSCQISCRSRRGGGGGGGGGFRGFSSGSA...SGGAGSSSEKGGSGSGEGCGSGVTFSFR Q3TTY5
 [6]  1505 MADRFSRFNEDRDFQGNHFDQYEEGHLEI...AATALHLHPLLHPIFSGQDLQHPPSHGT A2A6A1
 [7]   371 MSAQAQMRALLDQLMGTARDGDETRQRVK...RGPTDWRLENSNGKTASRRSEEKEAGEI Q9CYI4
 [8]   325 MSAQAQMRALLDQLMGTARDGDETRQRVK...RYRRHRSRSRSHSRGHRRASRDRSTKYK A0A0R4J047
 [9]   172 MDHLESFIAECDRRTELAKKRLAETQEEI...TVAEKQEKRNQDRLRRREEREREERLGR D3Z765
[10]   484 MATCSRQFTSSSSMKGSCGIGGGSSRMSS...NRQIRTKVMDVHDGKVVSTHEQVLRTKN Q61781
> acols(p)
DataFrame with 10 rows and 12 columns
      DB AccessionNumber        EntryName IsoformName
   <Rle>     <character>      <character>       <Rle>
1     sp          Q9Z2K1      K1C16_MOUSE          NA
2     tr          Q3SYP5     Q3SYP5_MOUSE          NA
3     sp          Q8BTI8      SRRM2_MOUSE          NA
4     sp          Q5SUF2      LC7L3_MOUSE          NA
5     sp          Q3TTY5       K22E_MOUSE          NA
6     sp          A2A6A1      GPTC8_MOUSE          NA
7     sp          Q9CYI4      LUC7L_MOUSE          NA
8     tr      A0A0R4J047 A0A0R4J047_MOUSE          NA
9     tr          D3Z765     D3Z765_MOUSE          NA
10    sp          Q61781      K1C14_MOUSE          NA
                                           ProteinName OrganismName GeneName
                                           <character>        <Rle>    <Rle>
1                      Keratin, type I cytoskeletal 16 Mus musculus    Krt16
2                                           Keratin 16 Mus musculus    Krt16
3          Serine/arginine repetitive matrix protein 2 Mus musculus    Srrm2
4                                  Luc7-like protein 3 Mus musculus   Luc7l3
5            Keratin, type II cytoskeletal 2 epidermal Mus musculus     Krt2
6                  G patch domain-containing protein 8 Mus musculus  Gpatch8
7             Putative RNA-binding protein Luc7-like 1 Mus musculus    Luc7l
8     Luc7 homolog (S. cerevisiae)-like, isoform CRA_c Mus musculus    Luc7l
9  Putative RNA-binding protein Luc7-like 1 (Fragment) Mus musculus    Luc7l
10                     Keratin, type I cytoskeletal 14 Mus musculus    Krt14
            ProteinExistence SequenceVersion Comment                             Filename
                       <Rle>           <Rle>   <Rle>                                <Rle>
1  Evidence at protein level               3      NA ~/Pbase/uniprot_proteome_mouse.fasta
2  Evidence at protein level               1      NA ~/Pbase/uniprot_proteome_mouse.fasta
3  Evidence at protein level               3      NA ~/Pbase/uniprot_proteome_mouse.fasta
4  Evidence at protein level               1      NA ~/Pbase/uniprot_proteome_mouse.fasta
5  Evidence at protein level               1      NA ~/Pbase/uniprot_proteome_mouse.fasta
6  Evidence at protein level               1      NA ~/Pbase/uniprot_proteome_mouse.fasta
7  Evidence at protein level               2      NA ~/Pbase/uniprot_proteome_mouse.fasta
8                  Predicted               1      NA ~/Pbase/uniprot_proteome_mouse.fasta
9  Evidence at protein level               1      NA ~/Pbase/uniprot_proteome_mouse.fasta
10 Evidence at protein level               2      NA ~/Pbase/uniprot_proteome_mouse.fasta
       npeps
   <integer>
1         10
2         10
3          2
4          7
5          7
6          7
7          2
8          2
9          2
10        10
> pcols(p)
SplitDataFrameList of length 10
$A0A0R4J047
DataFrame with 2 rows and 28 columns
     DB AccessionNumber        EntryName IsoformName
  <Rle>     <character>      <character>       <Rle>
1    tr      A0A0R4J047 A0A0R4J047_MOUSE          NA
2    tr      A0A0R4J047 A0A0R4J047_MOUSE          NA
                                                                      ProteinName
                                                                      <character>
1 tr|A0A0R4J047|A0A0R4J047_MOUSE Luc7 homolog (S. cerevisiae)-like, isoform CRA_c
2 tr|A0A0R4J047|A0A0R4J047_MOUSE Luc7 homolog (S. cerevisiae)-like, isoform CRA_c
  OrganismName GeneName ProteinExistence SequenceVersion Comment
         <Rle>    <Rle>            <Rle>           <Rle>   <Rle>
1 Mus musculus    Luc7l        Predicted               1      NA
2 Mus musculus    Luc7l        Predicted               1      NA
                                     spectrumID chargeState      rank passThreshold
                                       <factor>   <integer> <integer>     <logical>
1 controllerType=0 controllerNumber=1 scan=4303           2         1          TRUE
2 controllerType=0 controllerNumber=1 scan=4213           2         1          TRUE
  experimentalMassToCharge calculatedMassToCharge        sequence    modNum   isDecoy
                 <numeric>              <numeric>        <factor> <integer> <logical>
1                 791.8651               791.3703 AEQLGAEGNVDESQK         2     FALSE
2                 791.8632               791.3703 AEQLGAEGNVDESQK         2     FALSE
      post      pre     start       end                 DatabaseAccess DBseqLength
  <factor> <factor> <integer> <integer>                       <factor>   <integer>
1        I        K       140       154 tr|A0A0R4J047|A0A0R4J047_MOUSE         325
2        I        K       140       154 tr|A0A0R4J047|A0A0R4J047_MOUSE         325
  DatabaseSeq acquisitionNum filenames
     <factor>      <numeric>     <Rle>
1                       4303  120.mzid
2                       4213  120.mzid

$A2A6A1
DataFrame with 7 rows and 28 columns
     DB AccessionNumber   EntryName IsoformName
  <Rle>     <character> <character>       <Rle>
1    sp          A2A6A1 GPTC8_MOUSE          NA
2    sp          A2A6A1 GPTC8_MOUSE          NA
3    sp          A2A6A1 GPTC8_MOUSE          NA
4    sp          A2A6A1 GPTC8_MOUSE          NA
5    sp          A2A6A1 GPTC8_MOUSE          NA
6    sp          A2A6A1 GPTC8_MOUSE          NA
7    sp          A2A6A1 GPTC8_MOUSE          NA
                                                ProteinName OrganismName GeneName
                                                <character>        <Rle>    <Rle>
1 sp|A2A6A1|GPTC8_MOUSE G patch domain-containing protein 8 Mus musculus  Gpatch8
2 sp|A2A6A1|GPTC8_MOUSE G patch domain-containing protein 8 Mus musculus  Gpatch8
3 sp|A2A6A1|GPTC8_MOUSE G patch domain-containing protein 8 Mus musculus  Gpatch8
4 sp|A2A6A1|GPTC8_MOUSE G patch domain-containing protein 8 Mus musculus  Gpatch8
5 sp|A2A6A1|GPTC8_MOUSE G patch domain-containing protein 8 Mus musculus  Gpatch8
6 sp|A2A6A1|GPTC8_MOUSE G patch domain-containing protein 8 Mus musculus  Gpatch8
7 sp|A2A6A1|GPTC8_MOUSE G patch domain-containing protein 8 Mus musculus  Gpatch8
           ProteinExistence SequenceVersion Comment
                      <Rle>           <Rle>   <Rle>
1 Evidence at protein level               1      NA
2 Evidence at protein level               1      NA
3 Evidence at protein level               1      NA
4 Evidence at protein level               1      NA
5 Evidence at protein level               1      NA
6 Evidence at protein level               1      NA
7 Evidence at protein level               1      NA
                                     spectrumID chargeState      rank passThreshold
                                       <factor>   <integer> <integer>     <logical>
1 controllerType=0 controllerNumber=1 scan=3694           3         2          TRUE
2  controllerType=0 controllerNumber=1 scan=364           2         1          TRUE
3  controllerType=0 controllerNumber=1 scan=364           2         2          TRUE
4  controllerType=0 controllerNumber=1 scan=364           2         3          TRUE
5  controllerType=0 controllerNumber=1 scan=364           2         4          TRUE
6  controllerType=0 controllerNumber=1 scan=364           2         5          TRUE
7  controllerType=0 controllerNumber=1 scan=364           2         6          TRUE
  experimentalMassToCharge calculatedMassToCharge             sequence    modNum   isDecoy
                 <numeric>              <numeric>             <factor> <integer> <logical>
1                 801.3566               801.0378 RHSKRSHDSDDSDYTSSKHR         0     FALSE
2                 972.6678               972.1609      KKKHKKSSKHKRKHK         5     FALSE
3                 972.6678               972.1609      KKKHKKSSKHKRKHK         5     FALSE
4                 972.6678               972.1609      KKKHKKSSKHKRKHK         5     FALSE
5                 972.6678               972.1609      KKKHKKSSKHKRKHK         5     FALSE
6                 972.6678               972.1609      KKKHKKSSKHKRKHK         5     FALSE
7                 972.6678               972.1609      KKKHKKSSKHKRKHK         5     FALSE
      post      pre     start       end        DatabaseAccess DBseqLength DatabaseSeq
  <factor> <factor> <integer> <integer>              <factor>   <integer>    <factor>
1        S        R       907       926 sp|A2A6A1|GPTC8_MOUSE        1505            
2        A        K       673       687 sp|A2A6A1|GPTC8_MOUSE        1505            
3        A        K       673       687 sp|A2A6A1|GPTC8_MOUSE        1505            
4        A        K       673       687 sp|A2A6A1|GPTC8_MOUSE        1505            
5        A        K       673       687 sp|A2A6A1|GPTC8_MOUSE        1505            
6        A        K       673       687 sp|A2A6A1|GPTC8_MOUSE        1505            
7        A        K       673       687 sp|A2A6A1|GPTC8_MOUSE        1505            
  acquisitionNum filenames
       <numeric>     <Rle>
1           3694  120.mzid
2            364  120.mzid
3            364  120.mzid
4            364  120.mzid
5            364  120.mzid
6            364  120.mzid
7            364  120.mzid

$D3Z765
DataFrame with 2 rows and 28 columns
     DB AccessionNumber    EntryName IsoformName
  <Rle>     <character>  <character>       <Rle>
1    tr          D3Z765 D3Z765_MOUSE          NA
2    tr          D3Z765 D3Z765_MOUSE          NA
                                                                 ProteinName OrganismName
                                                                 <character>        <Rle>
1 tr|D3Z765|D3Z765_MOUSE Putative RNA-binding protein Luc7-like 1 (Fragment) Mus musculus
2 tr|D3Z765|D3Z765_MOUSE Putative RNA-binding protein Luc7-like 1 (Fragment) Mus musculus
  GeneName          ProteinExistence SequenceVersion Comment
     <Rle>                     <Rle>           <Rle>   <Rle>
1    Luc7l Evidence at protein level               1      NA
2    Luc7l Evidence at protein level               1      NA
                                     spectrumID chargeState      rank passThreshold
                                       <factor>   <integer> <integer>     <logical>
1 controllerType=0 controllerNumber=1 scan=4303           2         1          TRUE
2 controllerType=0 controllerNumber=1 scan=4213           2         1          TRUE
  experimentalMassToCharge calculatedMassToCharge        sequence    modNum   isDecoy
                 <numeric>              <numeric>        <factor> <integer> <logical>
1                 791.8651               791.3703 AEQLGAEGNVDESQK         2     FALSE
2                 791.8632               791.3703 AEQLGAEGNVDESQK         2     FALSE
      post      pre     start       end         DatabaseAccess DBseqLength DatabaseSeq
  <factor> <factor> <integer> <integer>               <factor>   <integer>    <factor>
1        I        K        54        68 tr|D3Z765|D3Z765_MOUSE         172            
2        I        K        54        68 tr|D3Z765|D3Z765_MOUSE         172            
  acquisitionNum filenames
       <numeric>     <Rle>
1           4303  120.mzid
2           4213  120.mzid

...
<7 more elements>
> pfeatures(p)
AAStringSetList of length 10
[["Q9Z2K1"]] Q9Z2K1=ASLENSLEETK Q9Z2K1=ASLENSLEETK ... Q9Z2K1=LAADDFR Q9Z2K1=LAADDFR
[["Q3SYP5"]] Q3SYP5=ASLENSLEETK Q3SYP5=ASLENSLEETK ... Q3SYP5=LAADDFR Q3SYP5=LAADDFR
[["Q8BTI8"]] Q8BTI8=PGPQALPK Q8BTI8=SGSSPEMKDKPR
[["Q5SUF2"]] Q5SUF2=KSYKHRSKSRDREQDRK Q5SUF2=KSYKHRSKSRDREQDRK ... Q5SUF2=MISAAQLLD
[["Q3TTY5"]] Q3TTY5=DYQELMNTK Q3TTY5=DYQELMNTK ... Q3TTY5=FASFIDK Q3TTY5=FASFIDK
[["A2A6A1"]] A2A6A1=RHSKRSHDSDDSDYTSSKHR A2A6A1=KKKHKKSSKHKRKHK ... A2A6A1=KKKHKKSSKHKRKHK
[["Q9CYI4"]] Q9CYI4=AEQLGAEGNVDESQK Q9CYI4=AEQLGAEGNVDESQK
[["A0A0R4J047"]] A0A0R4J047=AEQLGAEGNVDESQK A0A0R4J047=AEQLGAEGNVDESQK
[["D3Z765"]] D3Z765=AEQLGAEGNVDESQK D3Z765=AEQLGAEGNVDESQK
[["Q61781"]] Q61781=EVATNSELVQSGK Q61781=VTMQNLNDR ... Q61781=LAADDFR Q61781=LAADDFR
> lengths(pranges(p))
    Q9Z2K1     Q3SYP5     Q8BTI8     Q5SUF2     Q3TTY5     A2A6A1     Q9CYI4 A0A0R4J047 
        10         10          2          7          7          7          2          2 
    D3Z765     Q61781 
         2         10 
> delta <- pcols(p)[, "experimentalMassToCharge"] -
+   pcols(p)[, "calculatedMassToCharge"]
> ## assuming MSnID suggested a delta of 0.35
> sel <- abs(delta) < 0.35
> sel
LogicalList of length 10
[["A0A0R4J047"]] FALSE FALSE
[["A2A6A1"]] TRUE FALSE FALSE FALSE FALSE FALSE FALSE
[["D3Z765"]] FALSE FALSE
[["Q3SYP5"]] TRUE TRUE FALSE TRUE FALSE TRUE TRUE TRUE TRUE TRUE
[["Q3TTY5"]] TRUE TRUE TRUE TRUE TRUE TRUE TRUE
[["Q5SUF2"]] TRUE TRUE TRUE TRUE TRUE TRUE FALSE
[["Q61781"]] TRUE FALSE TRUE TRUE FALSE TRUE TRUE TRUE TRUE TRUE
[["Q8BTI8"]] FALSE TRUE
[["Q9CYI4"]] FALSE FALSE
[["Q9Z2K1"]] TRUE TRUE FALSE TRUE FALSE TRUE TRUE TRUE TRUE TRUE
> pranges(p) <- pranges(p)[sel]
Error in replacePranges(object, value) : 
  Names of replacement pranges differ from current ones.

> targets <- pcols(p)[,"isDecoy"]==FALSE
> targets
LogicalList of length 10
[["A0A0R4J047"]] TRUE TRUE
[["A2A6A1"]] TRUE TRUE TRUE TRUE TRUE TRUE TRUE
[["D3Z765"]] TRUE TRUE
[["Q3SYP5"]] TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE
[["Q3TTY5"]] TRUE TRUE TRUE TRUE TRUE TRUE TRUE
[["Q5SUF2"]] TRUE TRUE TRUE TRUE TRUE TRUE FALSE
[["Q61781"]] TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE
[["Q8BTI8"]] TRUE TRUE
[["Q9CYI4"]] TRUE TRUE
[["Q9Z2K1"]] TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE
> lengths(pranges(p))
    Q9Z2K1     Q3SYP5     Q8BTI8     Q5SUF2     Q3TTY5     A2A6A1     Q9CYI4 A0A0R4J047 
        10         10          2          7          7          7          2          2 
    D3Z765     Q61781 
         2         10 
> pranges(p) <- pranges(p)[targets]
Error in replacePranges(object, value) : 
  Names of replacement pranges differ from current ones


> sessionInfo()
R Under development (unstable) (2016-02-25 r70222)
Platform: x86_64-w64-mingw32/x64 (64-bit)
Running under: Windows >= 8 x64 (build 9200)

locale:
[1] LC_COLLATE=English_United States.1252  LC_CTYPE=English_United States.1252   
[3] LC_MONETARY=English_United States.1252 LC_NUMERIC=C                          
[5] LC_TIME=English_United States.1252    

attached base packages:
 [1] grid      stats4    parallel  stats     graphics  grDevices utils     datasets 
 [9] methods   base     

other attached packages:
[1] Pbase_0.11.3          Gviz_1.15.4           GenomicRanges_1.23.24 GenomeInfoDb_1.7.6   
[5] IRanges_2.5.39        S4Vectors_0.9.41      Rcpp_0.12.3           BiocGenerics_0.17.3  

loaded via a namespace (and not attached):
 [1] Biobase_2.31.3               httr_1.1.0                   vsn_3.39.2                  
 [4] AnnotationHub_2.3.14         splines_3.3.0                foreach_1.4.3               
 [7] Formula_1.2-1                shiny_0.13.1                 interactiveDisplayBase_1.9.0
[10] affy_1.49.0                  latticeExtra_0.6-28          BSgenome_1.39.4             
[13] Rsamtools_1.23.3             impute_1.45.0                RSQLite_1.0.0               
[16] lattice_0.20-33              biovizBase_1.19.4            limma_3.27.13               
[19] chron_2.3-47                 digest_0.6.9                 RColorBrewer_1.1-2          
[22] XVector_0.11.7               colorspace_1.2-6             preprocessCore_1.33.0       
[25] htmltools_0.3                httpuv_1.3.3                 plyr_1.8.3                  
[28] MALDIquant_1.14              XML_3.98-1.4                 biomaRt_2.27.2              
[31] zlibbioc_1.17.0              xtable_1.8-2                 scales_0.4.0                
[34] affyio_1.41.0                cleaver_1.9.0                BiocParallel_1.5.19         
[37] ggplot2_2.1.0                SummarizedExperiment_1.1.21  GenomicFeatures_1.23.25     
[40] nnet_7.3-12                  survival_2.38-3              magrittr_1.5                
[43] mime_0.4                     doParallel_1.0.10            foreign_0.8-66              
[46] mzR_2.5.3                    Pviz_1.5.0                   BiocInstaller_1.21.3        
[49] tools_3.3.0                  data.table_1.9.6             matrixStats_0.50.1          
[52] stringr_1.0.0                MSnbase_1.19.11              munsell_0.4.3               
[55] cluster_2.0.3                AnnotationDbi_1.33.7         ensembldb_1.3.17            
[58] Biostrings_2.39.12           pcaMethods_1.63.0            mzID_1.9.0                  
[61] RCurl_1.95-4.8               dichromat_2.0-0              iterators_1.0.8             
[64] VariantAnnotation_1.17.18    bitops_1.0-6                 gtable_0.2.0                
[67] codetools_0.2-14             DBI_0.3.1                    reshape2_1.4.1              
[70] R6_2.1.2                     GenomicAlignments_1.7.20     gridExtra_2.2.1             
[73] rtracklayer_1.31.7           Hmisc_3.17-2                 ProtGenerics_1.3.3          
[76] stringi_1.0-1                rpart_4.1-10                 acepack_1.3-3.3             

ADD REPLYlink written 2.8 years ago by viswanathan.raghuram0

The error is correct. That happens because your `aa` slot is not in alphabetical order. Maybe that's a bug. Could you send me the fasta and the mzID file?

ADD REPLYlink written 2.8 years ago by Sebastian Gibb80

You are correct I reconstruced the database. It is workingnow. Thanks a lot.I will keep you updated..

Thanks

 

ADD REPLYlink modified 2.8 years ago • written 2.8 years ago by viswanathan.raghuram0
> Sure...the fasta file is mouse uniprotproteome(~50,000 entries).
Ok, I can download it myself. I assume this one: http://www.uniprot.org/proteomes/UP000000589
> The mzid file is 50 MB. I was testing the the first 10 entries in the Proteins database. How shouldI send then to you.
Can you upload it somewhere (your university?, dropbox, google drive, https://www.wetransfer.com/, or whatever) and send me the link via email (find my email address via packageDescription("Pbase")$Maintainer in R).
ADD REPLYlink modified 2.8 years ago • written 2.8 years ago by Sebastian Gibb80

Its working now..

ADD REPLYlink written 2.8 years ago by viswanathan.raghuram0
Please log in to add an answer.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.2.0
Traffic: 365 users visited in the last hour